Protein Info for Psyr_0303 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Ferredoxin:Oxidoreductase FAD/NAD(P)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 3 to 69 (67 residues), 39.1 bits, E=5.9e-14
• PF00175: NAD_binding_1
  • amino acids 197 to 295 (99 residues), 55.9 bits, E=6.2e-19

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 100% identity to psb:Psyr_0303)

Predicted SEED Role

"CDP-6-deoxy-delta-3,4-glucoseen reductase-like"

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (1/3 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (1/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

See Q4ZZP6 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Psyr_0303 Ferredoxin:Oxidoreductase FAD/NAD(P)-binding protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRVTLQPSGAVLETLPGERILDAAQRLGYECPQSCRNGNCHVCSALLVEGRVMQSGQTLD
HGEIHTCVAEPLTECLVLWDGVLAKGELPVRSFACQLSECVEVGGDVWRVGLRAPAGKPP
RYHAGQYLMIERENGEKSAFSIASAPHSGRDLELHVLAREDSARSLIEQLQRNRMARVEL
PFGDTHLAELPDGPLVLIAAGTGMAQMNSLLEHCRSTGFSHPVHLYWGMRRPEDFYQVSH
WDEWAKLPNLFLHKVVSDLCGWEGRCGLLHEAVCEDIKDLSAVHVYASGSPAMIYGTLDA
LVDSGMDAHQMRADVFAYAPRP