Protein Info for Psyr_0269 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: cell division checkpoint GTPase YihA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 38 to 222 (185 residues), 228.4 bits, see alignment E=2.7e-72 PF01926: MMR_HSR1" amino acids 57 to 174 (118 residues), 57.9 bits, see alignment E=5.4e-20

Best Hits

Swiss-Prot: 100% identical to ENGB_PSEU2: Probable GTP-binding protein EngB (engB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03978, GTP-binding protein (inferred from 100% identity to psb:Psyr_0269)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZT0 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Psyr_0269 cell division checkpoint GTPase YihA (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRTHPNETDTSCRTPCRQVFTGNHMQLKNPILGLCQQATFMLSAAKVDQCPDDEGFEVAF
AGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLK
LHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDVLMLDWAIASNMPMHILLTKADKLTY
GAAKNTLLKVQAEIRKGWGDAVSIQLFSAPKRMGLEEAYTVLADWMELEDKAPAE