Protein Info for Psyr_0268 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 48 to 182 (135 residues), 28.3 bits, see alignment E=2.9e-10 PF01323: DSBA" amino acids 97 to 184 (88 residues), 57.3 bits, see alignment E=2.8e-19

Best Hits

Swiss-Prot: 95% identical to DSBA_PSESM: Thiol:disulfide interchange protein DsbA (dsbA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 99% identity to psp:PSPPH_0257)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZT1 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Psyr_0268 DSBA oxidoreductase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRNLIISAALVAASLFGMSAQAATPIEAGKQYVELASAVPVAEPGKIEVVELFWYGCPHC
YAFEPTINPWVEKLPSDVKFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQK
GGKRLTDKNDMADFVATQGVNKEDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNG
KYRFDLGSAGGPEKTLEVADQLIAKERAAAAAAK