Protein Info for Psyr_0071 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 306 to 329 (24 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 35 to 307 (273 residues), 273.3 bits, see alignment E=6.7e-85 PF17202: sCache_3_3" amino acids 109 to 214 (106 residues), 96.7 bits, see alignment E=2.5e-31 PF17203: sCache_3_2" amino acids 123 to 210 (88 residues), 30 bits, see alignment E=1.2e-10 PF00672: HAMP" amino acids 328 to 378 (51 residues), 56.3 bits, see alignment 8.4e-19 PF00015: MCPsignal" amino acids 445 to 623 (179 residues), 141.9 bits, see alignment E=4.6e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0071)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500M7 at UniProt or InterPro

Protein Sequence (658 amino acids)

>Psyr_0071 Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSKPRTRIASQLGIALAVILAVVISGSTLFALRSLDASNLVIREEHMSSEARLLADQLNT
FHSTLRDSTQRLSGLFEKRFAAGLSLQADKPVTVAGTSTPGLFLRDAALNNDFTEVDEFR
SMTAGVATIFVRSGDDFIRISTSLSKQDGTRAIGTVLDRKGAAYERLIAGQSYVGKAVLF
DRYYMTQYSPVRDSSGKIIAALFVGFDYTDAQKTQFDNLKSFRIGSTGSLALLDDKGTWL
VPPAGVKSLEGAAKSVAELASKPGKAQFWDDGDDNYYSVGQPFAGGPWTVIASMPRKEIS
EVTWHVGTQLAIGSLLAMLIAVISAIWLLRSKLRPLSELVRQADALGAGDLSVRLNVTSN
DEIGQLSGSFNKMSEALSSMVSHIRTAAQEVSTRANVLSGLSGGAFEGMEQQSGEITSMA
GAVEEFSATSMNIADNMGNTERLAQENAQQTRIGRTSMEEASSSLQQIATSLSSTAKVID
TLGQRSQEIGSIVGVITSIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTRE
ATDEISGMIASIQQETGNAISTMQQGNTLMQEGLSLNAKVASALAQIDEQSRSAGHQFAA
ITTATQEQSSTATMLSSNLQSIAMANSEQRQVMSNLAITAQELNGLATELRHEVDRFR