Protein Info for PfGW456L13_995 in Pseudomonas fluorescens GW456-L13

Annotation: Cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 63 to 85 (23 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details PF18075: FtsX_ECD" amino acids 100 to 191 (92 residues), 61.1 bits, see alignment E=1.3e-20 PF02687: FtsX" amino acids 217 to 332 (116 residues), 36.5 bits, see alignment E=4.5e-13

Best Hits

Swiss-Prot: 84% identical to FTSX_PSEPU: Cell division protein FtsX (ftsX) from Pseudomonas putida

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 96% identity to pfo:Pfl01_5335)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJT5 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PfGW456L13_995 Cell division protein FtsX (Pseudomonas fluorescens GW456-L13)
MSATRSPKVSERVAPKAADPQPQKKKHDDDDGPDFATLFRAWIESHRASLVDSLRRLGKQ
PIGSFFTCMVMAVALSLPMGLSLLLSNVERLGGSWQRAAQISLYLDLEAKPAEGEALRDQ
IKGMPGVAEAEYVGRDQALEEFQQQSGLGEALKELPENPLPGVVLVTPTEVDKPALEALR
QKLSELPKVQQAQLDLVWVERLAAILKLGDRFVFGLTVLLVSALLLVIGNTIRLHIENRR
TEIEVIKLVGGTDSYVRRPFLYMGALYGFGAGILSWGVLAFGLDWLNDAVVGLAGLYGSD
FALAGVPVADGLSLLLGAVLLGYIGAWIAVARHLRELAPK