Protein Info for PfGW456L13_977 in Pseudomonas fluorescens GW456-L13

Annotation: LSU m5C1962 methyltransferase RlmI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 6 to 72 (67 residues), 51.4 bits, E=3e-17
• PF02475: Met_10
  • amino acids 120 to 288 (169 residues), 35.6 bits, E=3.4e-12
• PF10672: Methyltrans_SAM
  • amino acids 173 to 346 (174 residues), 66.8 bits, E=7.5e-22
• PF03602: Cons_hypoth95
  • amino acids 215 to 303 (89 residues), 43 bits, E=1.7e-14
• PF13847: Methyltransf_31
  • amino acids 220 to 341 (122 residues), 36.4 bits, E=1.8e-12
• PF05175: MTS
  • amino acids 220 to 335 (116 residues), 35.7 bits, E=2.7e-12
• PF09445: Methyltransf_15
  • amino acids 222 to 346 (125 residues), 37.1 bits, E=9.7e-13
• PF01170: UPF0020
  • amino acids 244 to 342 (99 residues), 22.3 bits, E=3.8e-08

Best Hits

Swiss-Prot: 37% identical to RLMI_ERWT9: Ribosomal RNA large subunit methyltransferase I (rlmI) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 96% identity to pfo:Pfl01_5354)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A293QIU2 at UniProt or InterPro

Protein Sequence (398 amino acids)

>PfGW456L13_977 LSU m5C1962 methyltransferase RlmI (Pseudomonas fluorescens GW456-L13)
MSLPSLRLKANADRRLRNGHLWVYSNEIDVAATPLHGFKAGDQAILEAAGGKPLGIVAMS
PNNLICARLLSRDIKLPLDKSLLVHRLNVALSLRERLFDKPFYRLVYGDSDLLPGLVVDR
FGDILVVQIASATMEAHKDDVIAALTQVLKPSGILFKNDSAARDAEGLNRYVETVFGLVP
EWVALEENGVKFEAPVIQGQKTGWFYDHRMNRARLAPYAKGKRVLDLYSYIGGWGVQAAA
FGASEVFCVDASAFALDGVERNAALNGFAEKMTCIEGDVFEALKELKASEERFDVIVADP
PAFIKRKKDMKNGEGAYRRLNEQAMRLLTKDGILVSASCSMHLPEDDLQNILLTSARHLD
RNIQMLERGGQGPDHPVHPAIPETRYIKSITCRLLPNS