Protein Info for PfGW456L13_937 in Pseudomonas fluorescens GW456-L13

Annotation: Lysophospholipase (EC 3.1.1.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF12146: Hydrolase_4" amino acids 66 to 295 (230 residues), 105.9 bits, see alignment E=3.1e-34 PF00561: Abhydrolase_1" amino acids 70 to 154 (85 residues), 34.9 bits, see alignment E=2.1e-12 PF12697: Abhydrolase_6" amino acids 72 to 291 (220 residues), 51.2 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: None (inferred from 85% identity to pba:PSEBR_a5364)

Predicted SEED Role

"Lysophospholipase (EC 3.1.1.5)" in subsystem Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QFT5 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PfGW456L13_937 Lysophospholipase (EC 3.1.1.5) (Pseudomonas fluorescens GW456-L13)
MPATFDPDLLRASLLPLAAGQPLSAQAQAYQRFYGLDFAPRQVRSGLGRFEVDGYELVSQ
FWWPERAKATLFVIHGFYDHTGLYRHVIEWALDQGFAVIACDLPGHGLSSGERASIKDFA
EYQDALQGLFREAQSLDLPQPWHLCGQSTGGAIVIDHVLNAGASSPAQGQVILLSPLVRP
RAWGWSQLSYYLLKPFVKAIARRFSENSNDPAFLPFLQADPLQPLRLPTAWVGALARWIK
RIEAAPMSTRRPLIVQGQADMTVDWEHNLEVLRGKFDRPQVLMLPEARHHLANETLVMRQ
EYFGFLTRRIKGRNP