Protein Info for PfGW456L13_861 in Pseudomonas fluorescens GW456-L13

Annotation: Regulator of sigma D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF04353: Rsd_AlgQ" amino acids 1 to 141 (141 residues), 160.5 bits, see alignment E=1.6e-51

Best Hits

Swiss-Prot: 61% identical to ALGQ_PSEAE: Transcriptional regulatory protein AlgQ (algQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07740, regulator of sigma D (inferred from 93% identity to pfo:Pfl01_5482)

Predicted SEED Role

"Regulator of sigma D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QFQ0 at UniProt or InterPro

Protein Sequence (152 amino acids)

>PfGW456L13_861 Regulator of sigma D (Pseudomonas fluorescens GW456-L13)
MLESCQNAQERWGGVHLLIDRWLQERHELIGAYDALGAKPEALGENRKPLQEFCGVLVDY
VSAGHFEIYEQLTGEAKAFNDKRGLELAETIYPRIDVITEKLLAFNDLCDAGKCVAEEFK
TLGGLLHERFELEDCLIEVLHTAHKEADSVQA