Protein Info for PfGW456L13_821 in Pseudomonas fluorescens GW456-L13

Annotation: Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details PF01554: MatE" amino acids 20 to 178 (159 residues), 87.3 bits, see alignment E=4.7e-29 amino acids 246 to 412 (167 residues), 96.4 bits, see alignment E=7.5e-32 TIGR00797: MATE efflux family protein" amino acids 20 to 425 (406 residues), 231.3 bits, see alignment E=9.6e-73

Best Hits

Swiss-Prot: 73% identical to NORM_PSESM: Probable multidrug resistance protein NorM (norM) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 92% identity to pfl:PFL_6029)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QK50 at UniProt or InterPro

Protein Sequence (467 amino acids)

>PfGW456L13_821 Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog (Pseudomonas fluorescens GW456-L13)
MTMQHPARTELWAILRLAGPLIASQLAHMLMVLTDTLMMARLSPEALAGGGLGAATYSFV
SIFCIGVIAAVGTLVAIRQGAGDIVGATRLTQAGLWLAWLMALVAGLLLWNLKPVLLLFG
QTESNVNAAGQFLIFLPFALPGYLSFMALRGFTSAIGRATPVMVISVGGTVANFLLNYAL
ITGMFGLPKLGLTGIGLVTAIVANLMALALAWHIRRHPAYEAYPLRQGLSRLNRQYLKEL
WRLGLPIGGTYAVEVGLFAFAALCMGTMGSTQLGAHQIALQIVSVAFMVPAGISYAITMR
IGQHYGAGQLLDARLAGRVGIAFGAAAMLCFAMVFWLLPNQLVGLFLDHNDPAFRDVINL
AVSLLAVAAWFELFDGTQTIAMGCIRGLKDAKTTFLVGLGCYWLIGAPAAWWMAFHLDWG
PTGVWWGLALGLACAAVSLTLGFEWKMKRMIKRDTTSVQRFEVAQPD