Protein Info for PfGW456L13_776 in Pseudomonas fluorescens GW456-L13

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 87 to 109 (23 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 77 to 286 (210 residues), 347.8 bits, see alignment E=1.2e-108 PF01618: MotA_ExbB" amino acids 154 to 269 (116 residues), 111.3 bits, see alignment E=1.4e-36

Best Hits

Swiss-Prot: 81% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 90% identity to pfo:Pfl01_5555)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKF5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PfGW456L13_776 MotA/TolQ/ExbB proton channel family protein (Pseudomonas fluorescens GW456-L13)
VAALFFSLMLAPVAAFADAQAPATPAATAPAPADHAAPAVAPAATDPAQAAPTEALGEDV
PEVLEADNTLGMAHDLSPWGMYKNADIIVKIVMIGLAIASIITWTIWIAKGLELMGAKRR
LRGEIAQLKKSASLKEASATAAKEGTLANLLVHDALEEMRLSVNSREKEGIKERVSFRLE
RLVAACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAE
ALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLDHQPERSSQPHM
VKVG