Protein Info for PfGW456L13_775 in Pseudomonas fluorescens GW456-L13

Annotation: Biopolymer transport protein ExbD/TolR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details PF02472: ExbD" amino acids 14 to 134 (121 residues), 107.8 bits, see alignment E=2.2e-35 TIGR02803: TonB system transport protein ExbD" amino acids 16 to 137 (122 residues), 225.9 bits, see alignment E=5e-72

Best Hits

Swiss-Prot: 85% identical to EXBD_PSEPU: Biopolymer transport protein ExbD (exbD) from Pseudomonas putida

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 95% identity to pba:PSEBR_a5538)

MetaCyc: 68% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QFE1 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PfGW456L13_775 Biopolymer transport protein ExbD/TolR (Pseudomonas fluorescens GW456-L13)
MGLHLKEGADDDLSENHEINVTPFIDVMLVLLIIFMVAAPLATVDIKVDLPASTAKPAPR
PEKPVFLSVKADQRLFLGEDEVKADALGATLDAKTQGKKDTTIFFQADKGVDYGDLMSVM
DNLRSAGYLKVGLVGLETAAKK