Protein Info for PfGW456L13_772 in Pseudomonas fluorescens GW456-L13

Annotation: ATP-dependent DNA helicase RecG (EC 3.6.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 PF17191: RecG_wedge" amino acids 12 to 170 (159 residues), 64.2 bits, see alignment E=4e-21 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 27 to 663 (637 residues), 744.6 bits, see alignment E=5.5e-228 PF01336: tRNA_anti-codon" amino acids 61 to 132 (72 residues), 27.6 bits, see alignment E=7.8e-10 PF04851: ResIII" amino acids 272 to 429 (158 residues), 37.1 bits, see alignment E=1e-12 PF00270: DEAD" amino acids 291 to 434 (144 residues), 86.1 bits, see alignment E=8e-28 PF00271: Helicase_C" amino acids 479 to 585 (107 residues), 66.7 bits, see alignment E=7.2e-22 PF19833: RecG_dom3_C" amino acids 614 to 675 (62 residues), 54.9 bits, see alignment 2.7e-18

Best Hits

Swiss-Prot: 60% identical to RECG_ECO57: ATP-dependent DNA helicase RecG (recG) from Escherichia coli O157:H7

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 98% identity to pfo:Pfl01_5559)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJX6 at UniProt or InterPro

Protein Sequence (691 amino acids)

>PfGW456L13_772 ATP-dependent DNA helicase RecG (EC 3.6.1.-) (Pseudomonas fluorescens GW456-L13)
MGELSQVSVTALKGVGEAMAEKLAKVGLENLQDVLFHLPLRYQDRTRVVPIGALRPGQDA
VIEGTVSGADVVMGRRRSLVVRLQDGTGGLSLRFYHFSNAQKEGLKRGTRIRCYGEARPG
ASGLEIYHPEYRAITGDEPPPVDETLTPVYPLTEGLTQQRLRQLCMQTLTLLGPSSLPDW
LPSELARDYQLAPLADAIRYLHNPPADADVDELALGHHWAQHRLAFEELLTHQLSQQRLR
ESMRALRAPAIPKATKLPAKYLANLGFSPTGAQQRVGNEIAYDLSQHEPMLRLIQGDVGA
GKTVVAALAALQALEAGYQVALMAPTEILAEQHFITFKRWLEPLGIEVAWLAGKLKGKNR
VAALEQIASGTPMVVGTHALFQDEVQFKNLALVIIDEQHRFGVQQRLALRQKGVGGRMCP
HQLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVNTVLITDTRRVEVIERVRSACAE
GRQAYWVCTLIEESEELTCQAAETTFEDLTAALGELKVGLIHGRMKPAEKAAVMAEFKAG
NLQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSAVSHCVLLYHPPL
SQIGRQRLGIMRETNDGFVIAEKDLELRGPGEMLGTRQTGLLQFKVADLMRDADLLPAVR
DAAQALLERWPTHVSPLLDRWLRHGQQYGQV