Protein Info for PfGW456L13_771 in Pseudomonas fluorescens GW456-L13

Annotation: Predicted signal transduction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 254 to 274 (21 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF04073: tRNA_edit" amino acids 28 to 140 (113 residues), 42.4 bits, see alignment E=7.2e-15 PF08668: HDOD" amino acids 195 to 395 (201 residues), 157.6 bits, see alignment E=3e-50

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_5560)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKK9 at UniProt or InterPro

Protein Sequence (467 amino acids)

>PfGW456L13_771 Predicted signal transduction protein (Pseudomonas fluorescens GW456-L13)
MTDVAFAPDTPHAPSVIRLMLGKLGIAYEEVLDRHGLNAARKVQAVLLDDSIGVLMVLFP
QSQLLDLNRLTELTGRRLAAVPTERLTKMLGKHNLSLLPGLPALTSSPCLYDESLLREPK
LLINSGEPGVLLEITSEDFKATMLTKASAANFGENLTSIRPNLDRPDDDREEITQAVQAF
TARRIQQRLEATIEIPPLAETAQKIIKLRVDPNATIDDITGVVETDPALAAQVVSWAASP
YYASPGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKDHPQHSTPYWQQSIYTAAV
IEGLTRAMPRAQRPEAGLTYLAGLLHNFGYLLLAHVFPPHFSLICRHLEVNPHLCHSYIE
QHLLGISREQIGAWLMRHWDMPEELSTALRFQHDPAYDGAYAEYPNLVCLAVRLLRSRNI
GSGPDEDIPDALLERLGLSREKANDVVSKVLEAEMLLRELASQFTQG