Protein Info for PfGW456L13_703 in Pseudomonas fluorescens GW456-L13

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF02353: CMAS" amino acids 99 to 372 (274 residues), 361.3 bits, see alignment E=1.3e-111 PF06325: PrmA" amino acids 120 to 266 (147 residues), 22.7 bits, see alignment E=2.6e-08 PF13489: Methyltransf_23" amino acids 150 to 264 (115 residues), 35.9 bits, see alignment E=2.6e-12 PF05175: MTS" amino acids 151 to 232 (82 residues), 24 bits, see alignment E=1.1e-08 PF13847: Methyltransf_31" amino acids 159 to 261 (103 residues), 41.6 bits, see alignment E=4.2e-14 PF13649: Methyltransf_25" amino acids 164 to 259 (96 residues), 66.5 bits, see alignment E=1.2e-21 PF08242: Methyltransf_12" amino acids 164 to 260 (97 residues), 48.4 bits, see alignment E=5.2e-16 PF08241: Methyltransf_11" amino acids 164 to 261 (98 residues), 56.3 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 76% identical to FAMT_PSEPU: Probable fatty acid methyltransferase from Pseudomonas putida

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 94% identity to pfo:Pfl01_5666)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QF29 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PfGW456L13_703 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) (Pseudomonas fluorescens GW456-L13)
MLAHLPPALQNLQLPLRLRLWDGHEFNLGPTPSVTIVVKDPQMVTQFTHPSLDALGAAFV
EGKLELEGSISDVIRVCDEWSQALLDEGDDNQPVRNAHDKEMDAKAISYHYDLSNAFYQL
WLDSDMAYSCAYFETGSESLEQAQQAKFRHLCRKLRLQPGEYLLDVGCGWGGLARFAARE
FGAKVFGITLSKEQLALARERVKAEGLEDLVELQLLDYRDLPQDGRFDKVVSVGMFEHVG
HANLAEYCKTLFGAVKDGGLVMNHGITAKYTDGRPVGRGAGEFIGKYVFPNGELPHLSMI
SAEISEAGLEIVDVESLRLHYARTLDHWSERLEDNLEAASRLVPEQALRIWRLYLAGCAY
AFARGWINLHQILAVKAHADGSHELPWTRDDIYL