Protein Info for PfGW456L13_687 in Pseudomonas fluorescens GW456-L13

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 253 to 269 (17 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details PF11168: DUF2955" amino acids 11 to 147 (137 residues), 101.7 bits, see alignment E=1.7e-33

Best Hits

KEGG orthology group: None (inferred from 70% identity to reh:H16_A2415)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIY8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PfGW456L13_687 Membrane protein, putative (Pseudomonas fluorescens GW456-L13)
MRIERPPRVQRALRLSFGTALCLAASFGLALPIPFLSPMLALMMLAAMNRPLPFKASLGL
ILILMLTTGTGLLLIPLLRYYPFSGVLLVGLCLFLAFGYGLRGGNPLVATFLVVGLTLIS
SAGTAEFALALEVIVALVKGLFLAVTTLTISHWLFPDPASAPAAKPGPSLTPTESSWLAL
RATLVVLPTFLLAMIDPASYLPIIMKAVSLGQQSCATSARTAGQELLGSTLLGGLMAILF
WCALSLFVNLWMFFLWMLLFGLLVARKLYGVAMTRQPPSFWLNSLATLIILLGQSVQDSA
AGKDVYTAFAIRMGLFILVTLYACVMVHLLDMRRERRITTA