Protein Info for PfGW456L13_664 in Pseudomonas fluorescens GW456-L13

Annotation: DNA recombination and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00611: DNA replication and repair protein RecF" amino acids 2 to 349 (348 residues), 376.9 bits, see alignment E=5.4e-117 PF02463: SMC_N" amino acids 3 to 349 (347 residues), 133.2 bits, see alignment E=1.5e-42 PF13476: AAA_23" amino acids 4 to 35 (32 residues), 29.5 bits, see alignment (E = 1.8e-10) PF13304: AAA_21" amino acids 15 to 36 (22 residues), 28.1 bits, see alignment (E = 3.3e-10)

Best Hits

Swiss-Prot: 99% identical to RECF_PSEPF: DNA replication and repair protein RecF (recF) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 98% identity to pba:PSEBR_a3)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4UZ72 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PfGW456L13_664 DNA recombination and repair protein RecF (Pseudomonas fluorescens GW456-L13)
VRNLHPVTFSPSPRINILYGANGSGKTSVLEAIHLLGLARSFRSTRLLPVIQYEQLACTV
FGQVELAEGGHSALGISRDRQGEFQIRIDGQNARSAAQLAEILPLQLINPDSFRLLEGAP
KIRRQFLDWGVFHVEPRFMSTWQRLQKALRQRNSWLRHGTLDAVSQAVWDRELCQASAEI
DEYRRAYIKALKPVFEQTLSELVELEGLTLSYYRGWDKDRELSAVLAGSLQRDQQMGHTQ
AGPQRADLRLRLGAHNAADILSRGQQKLVVCALRIAQGHLVSQARRGQCIYLVDDLPSEL
DEHHRRALCRLLEDLRCQVFITCVDHELLREGWQTETPVALFHVEQGRITQTHDHRE