Protein Info for PfGW456L13_648 in Pseudomonas fluorescens GW456-L13

Annotation: Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 229 to 252 (24 residues), see Phobius details PF21102: DprA_N" amino acids 15 to 50 (36 residues), 29 bits, see alignment 1e-10 TIGR00732: DNA protecting protein DprA" amino acids 79 to 297 (219 residues), 254.5 bits, see alignment E=3.1e-80 PF02481: DNA_processg_A" amino acids 84 to 288 (205 residues), 248 bits, see alignment E=8.4e-78 PF17782: DprA_WH" amino acids 312 to 361 (50 residues), 32.1 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 87% identity to pfo:Pfl01_0019)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJK1 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PfGW456L13_648 Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake (Pseudomonas fluorescens GW456-L13)
MSLSAVTPVSPAELEARLRLHRLPELGPARFKKLLEAFGSASKAISAPASAWRALGLPLA
CSEARRSTEIRDGASHALAWLERPAQHLLMWDQPDYPALLAQISDAPPLLFVAGDPGILE
KPQLAMVGSRRASRPGMDTAAAFSRSLAGAGFVITSGLALGIDAAAHQAALDVGGQTVGV
LGTGLEKFYPQRNRRLADAMIASGSAVLSEFPLDAGPSASNFPRRNRIISGLSLGVLVVE
ASVASGSLITARLAAEQGREVFAMPGSIHHPGARGCHQLIRDGAVLVETIEHILEALRGW
QRLSLSTETCTPATTHPLLKLLHVAPHTSEALADASGWALPKVLAALTELEMDGRAVCEN
GRWFARVS