Protein Info for PfGW456L13_643 in Pseudomonas fluorescens GW456-L13

Annotation: Sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 328 to 370 (43 residues), see Phobius details amino acids 386 to 415 (30 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details PF00916: Sulfate_transp" amino acids 27 to 392 (366 residues), 278.9 bits, see alignment E=8.8e-87 PF01740: STAS" amino acids 435 to 513 (79 residues), 36.9 bits, see alignment E=4e-13 PF13466: STAS_2" amino acids 453 to 509 (57 residues), 33.2 bits, see alignment 7.2e-12

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_0024)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PWW9 at UniProt or InterPro

Protein Sequence (522 amino acids)

>PfGW456L13_643 Sulfate permease (Pseudomonas fluorescens GW456-L13)
MALPSRHSLFPFLTWLPRQTRASVGRDLIVGLSGAILALPQSIAYALIAGLPPEYGLYAA
IIPVLIACLWGSSWHLICGPTAAISIVLYASVSPLAVPASQDYVMLILLLTFLAGIFQWL
LGLLRFGALVNFVSHSVVLGFTLGAAVVIAIGQLPNLLGLDLPSQATALDSFITLLRHLG
EMDKPSLALGLATVVVGVILKLLLPRWPTLLITLILGGLLVWLWPSMFGHVQLVSAFTGK
LPPFSPLPLDLDLILRLLPSAVAVGMLGLVTSLSIARSISARSQQLLDANQEVRAQGLSN
IVGAFFSGSLSAGSFTRSGLSYEAGACSPLAGIFSALWVALFAIFGASLIAHIPIPAMAG
SILLIAWGLVDHRGIRALLRVSRAEFVVMALTCVATLLLELQTAIYAGVLASLFFYLKRT
SQPRVQHVRDGEEDILRVGGSIFFGASHYLQVRLQRMHGARVVIEAQQINFIDYSGVEML
HQEARRLLRQDRSLTLRRARPQVVEELRKLEGAEKCPIRFED