Protein Info for PfGW456L13_615 in Pseudomonas fluorescens GW456-L13

Annotation: Cytochrome c oxidase polypeptide II (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details PF02790: COX2_TM" amino acids 11 to 92 (82 residues), 46.3 bits, see alignment E=8.1e-16 TIGR02866: cytochrome c oxidase, subunit II" amino acids 20 to 239 (220 residues), 188.8 bits, see alignment E=4.3e-60 PF00116: COX2" amino acids 109 to 228 (120 residues), 123.3 bits, see alignment E=1.1e-39 PF13442: Cytochrome_CBB3" amino acids 264 to 336 (73 residues), 42.9 bits, see alignment E=1e-14 PF00034: Cytochrom_C" amino acids 264 to 336 (73 residues), 31.2 bits, see alignment E=9.5e-11

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 94% identity to pfo:Pfl01_0079)

MetaCyc: 87% identical to cytochrome c oxidase subunit 2 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QK42 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PfGW456L13_615 Cytochrome c oxidase polypeptide II (EC 1.9.3.1) (Pseudomonas fluorescens GW456-L13)
LWSIFSQAQAAWTVNMAPGATEISHAVFDLHMIIFWICVVIGIIVFGAMFWSMILHRRST
GQVAAKFHESTTVEILWTIVPFLILVAMAVPATATLIKMYDASEPEIDIQITGYQWKWHY
KYLGQDVEFFSNLTTPQDQIHNKEAKGEHYLLEVDKPLVLPVGAKVRFLVTSADVIHSWW
VPAFAVKRDAIPGFVNEAWTRIDKPGIYRGQCAELCGKDHGFMPTVVEVKEKADYEKWLA
DRKAEAAQLKELTSKEWTLEELKERGDKVYHTTCVACHQAEGQGLPPMFPALKGSKIATG
PKDAHLSIVFHGKPGTSMAAFGKQLSEVDIAAVVTYERNAWGNNKGDMVTPKEVLELKQA
ESK