Protein Info for PfGW456L13_593 in Pseudomonas fluorescens GW456-L13

Annotation: GTP-binding protein EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 15 to 198 (184 residues), 229.8 bits, see alignment E=1e-72 PF01926: MMR_HSR1" amino acids 33 to 150 (118 residues), 60 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 99% identical to ENGB_PSEPF: Probable GTP-binding protein EngB (engB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03978, GTP-binding protein (inferred from 99% identity to pfo:Pfl01_0055)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QH72 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PfGW456L13_593 GTP-binding protein EngB (Pseudomonas fluorescens GW456-L13)
MQLKNPILGLCQQSTFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTS
KTPGRTQLLNFFKLDDERRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGGRESLKGLILMM
DIRHPMTDFDLLMLDWAVAAGMPMHILLTKADKLTYGAAKNTLLKVQAEIRKGWGDLVTI
QLFSAPKRMGLEDAYTVLAGWMELADKGAEAEIQ