Protein Info for PfGW456L13_584 in Pseudomonas fluorescens GW456-L13

Annotation: alginate biosynthesis transcriptional regulatory protein AlgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00072: Response_reg" amino acids 11 to 119 (109 residues), 105 bits, see alignment E=6.5e-34 PF00158: Sigma54_activat" amino acids 149 to 314 (166 residues), 214.6 bits, see alignment E=1.9e-67 PF14532: Sigma54_activ_2" amino acids 151 to 318 (168 residues), 53.2 bits, see alignment E=9.8e-18 PF07728: AAA_5" amino acids 170 to 289 (120 residues), 25.2 bits, see alignment E=3.7e-09 PF02954: HTH_8" amino acids 406 to 446 (41 residues), 36.7 bits, see alignment 6.9e-13

Best Hits

Swiss-Prot: 94% identical to ALGB_PSESM: Alginate biosynthesis transcriptional regulatory protein AlgB (algB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a49)

Predicted SEED Role

"alginate biosynthesis transcriptional regulatory protein AlgB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJD1 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PfGW456L13_584 alginate biosynthesis transcriptional regulatory protein AlgB (Pseudomonas fluorescens GW456-L13)
MESATEHQGRILLVDDESAILRTFRYCLEDEGYSVATATSAAQAEALLQRQVFDLCFLDL
RLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAADYLVKPCSPDQLRLAT
AKQLEVRQLSARLEALEGEVRKPMDGLDSHSPAMKVVLETARQVATTDANILILGESGTG
KGELSQAIHGWSKRAKKSCVTINCPSLTAELMESELFGHSRGAFTGASESTLGRVNQADG
GTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADVRILAATNLNLEDMVRDGRF
REDLLYRLNVITLHLPPLRERREDILNLADRFLARFVKEYARPARVFSDEAREALLGYRW
PGNIRELRNVIERASIICPQERVEISHLGMAETPVNNAPRIGAALSLDELEKAHIGAVLA
TADTLDQAAKTLGIDASTLYRKRKQYNL