Protein Info for PfGW456L13_534 in Pseudomonas fluorescens GW456-L13

Annotation: Type I secretion system ATPase, LssB family LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 transmembrane" amino acids 168 to 191 (24 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details amino acids 390 to 415 (26 residues), see Phobius details amino acids 421 to 445 (25 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 20 to 714 (695 residues), 965.1 bits, see alignment E=1.1e-294 PF00664: ABC_membrane" amino acids 173 to 432 (260 residues), 75 bits, see alignment E=8.2e-25 PF00005: ABC_tran" amino acids 501 to 650 (150 residues), 113.6 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: K12541, ATP-binding cassette, subfamily C, bacterial LapB (inferred from 96% identity to pfo:Pfl01_0135)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIK1 at UniProt or InterPro

Protein Sequence (718 amino acids)

>PfGW456L13_534 Type I secretion system ATPase, LssB family LapB (Pseudomonas fluorescens GW456-L13)
VESEVSRVQLIHDPRALHDDPLLDGLLALCMLHQKPASAAMLTTGLPLPEQRLSVELLPR
AAARAGLQGRVLQRKLEDIPAIAMPALLLLRDGRSAVLLGWQGEDQVRVLLSESDGGESL
VSRDLLADDYTGKVFFAQPQHKFDVNHGTLIPRARSWFRDTLKRSRWLYADAIAASFLIN
IIAMAAPLFVMNVYDRVVPNQAEATLWVLALGITGAYLFDLILKSLRSLCLDLAGKKTDL
IISATLFERIVGMAMKYRPARVGSFAQNIHEFQSLRDFLASLTLTSLIDLPFTILIFIVI
AILGGHLVWIPVLAFPIALAIGYALQKPLVATMERTMALGAERQSSLIETLAGLDAVKVN
NAESERQYQWEQTIGTLSRLELRVKMLSGLAMNITLLIQQLAGVIMIVFGVYQIIDGHLS
MGGLIACYMLSGRALSPLASLSGLLTRYQQARVTMTSVDQMMELPQERNFEERPLSRKVL
QGGIECRQLNFTYPQQQNLALKNINLSISPGEKVGIIGRSGSGKSSLAKLLVGLYQPDDG
ALLVDGVDIRQIDVSELRYNIGYVPQDIQLLAGTLRDNLVSGARYVEDELVLQAAELAGV
HEYARLHPQGYELQVGERGQNLSGGQRQNVALARALLLNPPILLLDEPTSAMDNTGEERL
KQRLAAVIENKTMVLVTHRASLLSLVDRLIVVDRGQILADGPKAAVMEALKKGQISVA