Protein Info for PfGW456L13_533 in Pseudomonas fluorescens GW456-L13

Annotation: Type I secretion system, membrane fusion protein LapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 38 to 454 (417 residues), 436.7 bits, see alignment E=4.8e-135 PF13533: Biotin_lipoyl_2" amino acids 80 to 116 (37 residues), 27 bits, see alignment 4.4e-10 PF16576: HlyD_D23" amino acids 272 to 373 (102 residues), 30.5 bits, see alignment E=3.4e-11 PF13437: HlyD_3" amino acids 305 to 413 (109 residues), 61.2 bits, see alignment E=2.2e-20

Best Hits

KEGG orthology group: K12542, membrane fusion protein LapC (inferred from 96% identity to pfo:Pfl01_0136)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PWS1 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PfGW456L13_533 Type I secretion system, membrane fusion protein LapC (Pseudomonas fluorescens GW456-L13)
VLLKSGKGSILRYFKGSASLQGQPLPEVNKALIEDAPRVVRLTIWAIIAFFVFLMLWANF
AVIDEVTKGDGKAIPSSKIQKIQNLEGGIVAELFVKEGQIVEAGAPLIRLDDTRFASNVG
ETEADRLSMLLRVERLSAEVEERPLNFPEDVLKAVPGQAKSEESLYISRRQQLHDEIGGL
QEQLIQRQQELREFTSKQAQYRQQLGFQRQEISMSEPLVAQGAVSPVEVLRLRRAEAETR
GQLDATTLAIPRAESAIKEVQRKVDETRGKFRSEALTQLNEARTDLNKAQATGKALEDRV
SRTLVTSPVRGIVNKLLVNTIGGVIQPGSDLVEIVPLDDTLLVEAKIRPQDIAFLHPGQE
ATVKFTAYDYTIYGGMKAKLEQIGADTITDEDKKTTYYIIKLRTDRSHLGTDEKPLLIIP
GMVASVDIITGKKTVLSYLLKPIIRARAEALHER