Protein Info for PfGW456L13_514 in Pseudomonas fluorescens GW456-L13

Annotation: Adenylylsulfate kinase (EC 2.7.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 13 to 190 (178 residues), 199 bits, E=2.7e-63
• PF06414: Zeta_toxin
  • amino acids 18 to 67 (50 residues), 23.4 bits, E=7.3e-09
• PF01583: APS_kinase
  • amino acids 26 to 175 (150 residues), 172.9 bits, E=1e-54
• PF08433: KTI12
  • amino acids 30 to 104 (75 residues), 30.5 bits, E=5.6e-11
• PF13671: AAA_33
  • amino acids 30 to 141 (112 residues), 31.3 bits, E=4.8e-11

Best Hits

Swiss-Prot: 48% identical to CYSC_BACLD: Adenylyl-sulfate kinase (cysC) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 89% identity to pfo:Pfl01_0162)

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A293QII0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PfGW456L13_514 Adenylylsulfate kinase (EC 2.7.1.25) (Pseudomonas fluorescens GW456-L13)
MPQHVDVKAPTASISRAQRERRNGHRGAAILLTGLPAAGKSTLAQALHAELFARGLQSVV
LDGDGLRVGLNRDLGFSDSDRQENIRRASELASLLVENGQIVILAMIAPLVELRDVFARR
LGDDYREVWCSATLAVCEQRDPKGHYARARRGELTGFTGVSAPYQAPVDAALVLDTGIQS
VEACLDRLLTWLGESAVLPRP