Protein Info for PfGW456L13_5115 in Pseudomonas fluorescens GW456-L13

Annotation: Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 34 to 114 (81 residues), 51.5 bits, E=4.5e-18
  • amino acids 162 to 246 (85 residues), 49.2 bits, E=2.3e-17

Best Hits

Swiss-Prot: 40% identical to LUTA_BACSU: Lactate utilization protein A (lutA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00104, glycolate oxidase [EC: 1.1.3.15] (inferred from 96% identity to pfo:Pfl01_0752)

MetaCyc: 40% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• Bifidobacterium shunt (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• homolactic fermentation (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• photorespiration I (6/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27 or 1.1.3.15

Sequence Analysis Tools

See A0A293QV47 at UniProt or InterPro

Protein Sequence (274 amino acids)

>PfGW456L13_5115 Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE (Pseudomonas fluorescens GW456-L13)
MSELFYNAVPNATRVAPPLPEPRQYPSEKPSRVYLFGTCVVDLFYPEAGMDAIHLLEREG
IRVEYPQGQSCCGQPAYTSGYTEQARTVARSQLALFAGDYPVVVPSGSCAGMLREHYADL
FKDEPDTLKQVQALAARTYELAEFLLFVCKVQLKDGGEPVKVALHTSCSARREMNTHLHG
RELLAQLSNVERVNHDHESECCGFGGTFSVRMPDISGAMVADKTRALKESGAHKVLSADC
GCLMNINGSLEKQQEALRGQHLASFLWQRTGGVK