Protein Info for PfGW456L13_5098 in Pseudomonas fluorescens GW456-L13

Annotation: Transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF03449: GreA_GreB_N" amino acids 1 to 69 (69 residues), 90.2 bits, see alignment E=8e-30 TIGR01462: transcription elongation factor GreA" amino acids 1 to 150 (150 residues), 173.2 bits, see alignment E=1.9e-55 PF01272: GreA_GreB" amino acids 78 to 151 (74 residues), 97.3 bits, see alignment E=4.1e-32

Best Hits

Swiss-Prot: 93% identical to GREA_PSESM: Transcription elongation factor GreA (greA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 96% identity to pfl:PFL_0832)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QST9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>PfGW456L13_5098 Transcription elongation factor GreA (Pseudomonas fluorescens GW456-L13)
MTVQGARALEEEHTHLTKVVRPKLSQDIGTARELGDLKENAEYHAAREQQGMVEARIRDI
EGRMQNAVIIDVTTIPHSGKVIFGTTVEIANVETDESVTYQIVGEDEADIKLGKISVGSP
IARALIAKEEGDVVAVKTPGGVIEYEIVEVRHV