Protein Info for PfGW456L13_5069 in Pseudomonas fluorescens GW456-L13

Annotation: Iron-uptake factor PiuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF13640: 2OG-FeII_Oxy_3" amino acids 84 to 176 (93 residues), 48.4 bits, see alignment E=1.5e-16 PF18331: PKHD_C" amino acids 183 to 225 (43 residues), 75.6 bits, see alignment 2.5e-25

Best Hits

Swiss-Prot: 98% identical to Y799_PSEPF: PKHD-type hydroxylase Pfl01_0799 (Pfl01_0799) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 98% identity to pfo:Pfl01_0799)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QW29 at UniProt or InterPro

Protein Sequence (226 amino acids)

>PfGW456L13_5069 Iron-uptake factor PiuC (Pseudomonas fluorescens GW456-L13)
MLLHIPGLFEKDEVQRIREALEQADWADGKITAGYQSAKAKHNLQLPEGHPLAKEIGAAM
LERLWKNPLFMSAALPHKVFPPLVNCYTAGGSFDFHIDNAVRQPKGSIERVRTDLSATLF
FSEPEDYDGGELEIQDTFGTQRVKLPAGDMVLYPGTSLHKVNAVTRGARLASFFWTQSLV
REDSQRALLFEMDGAIQQLTQDMPDHPSLIRLTGTYHNLLRRWVEV