Protein Info for PfGW456L13_5054 in Pseudomonas fluorescens GW456-L13

Annotation: Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00496: SBP_bac_5" amino acids 69 to 450 (382 residues), 337.6 bits, see alignment E=4.9e-105

Best Hits

Swiss-Prot: 47% identical to DPPA_ECOLI: Periplasmic dipeptide transport protein (dppA) from Escherichia coli (strain K12)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 95% identity to pfo:Pfl01_0813)

MetaCyc: 47% identical to dipeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS43 at UniProt or InterPro

Protein Sequence (531 amino acids)

>PfGW456L13_5054 Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2) (Pseudomonas fluorescens GW456-L13)
MKMLPLRAAIAAALLSVAVGVSAKPLVVCTEASPEGFDMVQYTTAVTADAVAETIFNRLA
DFKPGTTDVIPALADSWDISEDGLTYTFHLRKGVKFHTTEYFKPTRDMNADDVVWSFQRQ
LDPNHPWHKLSSVGFPYFESMGFKELLKSVEKVDDNTVKFTLTRREAPFLADIAMAFSSI
YSAEYADLLLKANKTGDLNNKPIGTGPFVFQRYNKDAQVRFKANPDYFRGKPPADALILA
IATDNNVRLQKLKANECQVALYPKPDDIPSIKKDDKLKVDELNAMTVSYIAMNTTHKYMS
DVRVRKAIDIAFDKEAYVNALFGKGNATAAVNPYPDTLLGYNHSLKNPARDLDKARALLK
EAGVPEGTTFTLFTRNGGGPTNPNPMLGAQMMQADLAKVGIKIDIRVMEWGEMLKRAKNG
EHDMVSAGWAGDNGDPDNFLTPMLSCEAAKNGENYARWCNDKFQALLDQAREKTDPAERA
ALYEQAQVIFNQDQPWISMAHTRMFTAMRNNVEGYHISPLTTNNFATTQVK