Protein Info for PfGW456L13_5053 in Pseudomonas fluorescens GW456-L13

Annotation: Outer membrane porin, OprD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03573: OprD" amino acids 45 to 476 (432 residues), 403.8 bits, see alignment E=4.5e-125

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfo:Pfl01_0814)

Predicted SEED Role

"Outer membrane porin, OprD family" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS31 at UniProt or InterPro

Protein Sequence (477 amino acids)

>PfGW456L13_5053 Outer membrane porin, OprD family (Pseudomonas fluorescens GW456-L13)
MKLSSTALLAMAISSVTATAYAETQSQAFTPVTVNEKSAQSEATGFIEGQSITGTTRNWY
ANEQLQRGAKFAYKKDGVSTPTDRRINWVQGTILKYNSGFTEGTVGFSTEVAAYNAIALD
QDRKDLASNNGGAPGTRPGAGNNRTLTKEGGDAQGQWSKLGLANVKARVSNSTLTAGRMN
FSSPMVDVIGNRALPSSFQGVALHSEELNNLAFDLATFDRNSPRTEESQRKFRTEYANGI
VETDHVYTGGITYNPFASLTTSLWATQAEDIWNQYYFGASHVLGDSQVLSLTTGLNYYKT
KETGKALIGDIDNDTYSLSFGLTHQAHTLTFSYQEVNGNEYFDYLHETNGIYLANSLLSD
FNGPNEKSFQVAYGLNMAEYGVPGLKFNIYQARGWGIDGTHYTGNGGVAGKGYDGIQSQD
GEHHYEYGIGATYAVQSGPLKATTIRGTYTAHRASENQADGSINEFRLVTTVPFNIL