Protein Info for PfGW456L13_4979 in Pseudomonas fluorescens GW456-L13
Annotation: Dihydroneopterin triphosphate epimerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to FOLX_ECOLI: Dihydroneopterin triphosphate 2'-epimerase (folX) from Escherichia coli (strain K12)
KEGG orthology group: K07589, D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC: 5.-.-.-] (inferred from 94% identity to pfl:PFL_0948)MetaCyc: 61% identical to dihydroneopterin triphosphate 2'-epimerase (Escherichia coli K-12 substr. MG1655)
H2NTPEPIM-RXN [EC: 5.1.99.7]
Predicted SEED Role
"Dihydroneopterin triphosphate epimerase" in subsystem Folate Biosynthesis
MetaCyc Pathways
- tetrahydromonapterin biosynthesis (3/4 steps found)
KEGG Metabolic Maps
- Biosynthesis of steroids
- Carotenoid biosynthesis - General
- Lipopolysaccharide biosynthesis
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.-.-.-
Use Curated BLAST to search for 5.-.-.- or 5.1.99.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QRX7 at UniProt or InterPro
Protein Sequence (123 amino acids)
>PfGW456L13_4979 Dihydroneopterin triphosphate epimerase (Pseudomonas fluorescens GW456-L13) MPQLQPGMARIRVKDLCLRTFIGINEDEILNKQDVLINLTILYAAQEAVRDNDIDHALNY RTITKAIIAHVEGNRFALLERLTQEILDLVMANASVLYAEVEVDKPHALRFAESVSITLA ASR