Protein Info for PfGW456L13_4947 in Pseudomonas fluorescens GW456-L13

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00892: EamA" amino acids 5 to 134 (130 residues), 51.8 bits, see alignment E=5.1e-18 amino acids 149 to 285 (137 residues), 50.2 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_0934)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QUN0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PfGW456L13_4947 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens GW456-L13)
MNLSLYLLTVLIWGTTWIALKWQLGVVAIPVSIVYRFGLAALVLFVILLLSRRLQVMNRR
GHLICLAQGLCLFCVNFMCFLTASQWIPSGLVAVVFSTATLWNALNARVFFGQRIARNVL
MGGALGLLGLGLLFWPELAGHTASPETLLGLGLALCGTLCFSAGNMLSSLQQKAGLKPLT
TNAWGMAYGAAMLTVWCLVKGIPFDMEMSTRYIGSLLYLVIPGSVIGFTAYLTLVGRMGP
ERAAYCTVLFPVVALNVSAFAEGYQWTMPALLGLVLVMSGNVLVFRKPKPRLVQGSSKLA