Protein Info for PfGW456L13_4916 in Pseudomonas fluorescens GW456-L13

Annotation: Phosphate regulon transcriptional regulatory protein PhoB (SphR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00072: Response_reg" amino acids 7 to 117 (111 residues), 86.6 bits, see alignment E=1.4e-28 PF00486: Trans_reg_C" amino acids 155 to 231 (77 residues), 96.8 bits, see alignment E=6.3e-32

Best Hits

Swiss-Prot: 44% identical to MTRA_MYCPA: DNA-binding response regulator MtrA (mtrA) from Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)

KEGG orthology group: None (inferred from 85% identity to bcn:Bcen_1561)

MetaCyc: 40% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QUJ4 at UniProt or InterPro

Protein Sequence (239 amino acids)

>PfGW456L13_4916 Phosphate regulon transcriptional regulatory protein PhoB (SphR) (Pseudomonas fluorescens GW456-L13)
MEQTKRVLVVEDDMHIADLICLHLRDEQFEVVHSADGNEGMRLLQQGNWDALVLDLMLPG
VDGLEICRRARAMARYTPIIITSARSSEVHRILGLELGADDYLAKPFSMLELVARVKALL
RRVDAMARNLKMDAGSLLTDGLAIDPITREVSLDGRRLDLTPREFDLLYFFARQPGKVFS
RMDLLNAVWGYSHEGYEHTVNTHINRLRAKIEADPAQPVRILTVWGRGYKFATGEEPQP