Protein Info for PfGW456L13_4909 in Pseudomonas fluorescens GW456-L13

Annotation: YoeB toxin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 84 PF06769: YoeB_toxin" amino acids 5 to 84 (80 residues), 132.6 bits, see alignment E=2.1e-43 TIGR02116: addiction module toxin, Txe/YoeB family" amino acids 5 to 84 (80 residues), 114.8 bits, see alignment E=8.2e-38

Best Hits

Swiss-Prot: 70% identical to YOEB_SYNY3: Toxin YoeB (yoeB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 88% identity to pfs:PFLU5132)

MetaCyc: 62% identical to ribosome-dependent mRNA interferase toxin YoeB (Escherichia coli K-12 substr. MG1655)
RXN0-4701

Predicted SEED Role

"YoeB toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QWD2 at UniProt or InterPro

Protein Sequence (84 amino acids)

>PfGW456L13_4909 YoeB toxin protein (Pseudomonas fluorescens GW456-L13)
MNIEFTPEAWDDYLWFQQNDKAGLKRINLLIKAIQREPFDGLGKPEPLKHNLSGFWSRRI
TAEHRLVYAIEDGEIHVVMCRYHY