Protein Info for PfGW456L13_4812 in Pseudomonas fluorescens GW456-L13

Annotation: tRNA (5-methoxyuridine) 34 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 9 to 318 (310 residues), 493.5 bits, E=5.4e-152
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 9 to 317 (309 residues), 468.9 bits, E=2.9e-145
• PF13489: Methyltransf_23
  • amino acids 112 to 266 (155 residues), 55.9 bits, E=1.1e-18
• PF13847: Methyltransf_31
  • amino acids 118 to 226 (109 residues), 28.5 bits, E=3e-10
• PF13649: Methyltransf_25
  • amino acids 122 to 216 (95 residues), 31.9 bits, E=4.5e-11
• PF08241: Methyltransf_11
  • amino acids 123 to 220 (98 residues), 28.1 bits, E=6.5e-10

Best Hits

Swiss-Prot: 96% identical to CMOB_PSEPF: tRNA U34 carboxymethyltransferase (cmoB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 96% identity to pfo:Pfl01_4583)

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A293QTP4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PfGW456L13_4812 tRNA (5-methoxyuridine) 34 synthase (Pseudomonas fluorescens GW456-L13)
MIDLSPLARRLAGTPLAEWANTLQAQLDKKMEKGHGDLERWQSALDALPKIQPSEVDLLN
GLKLDTDCSDETRAQMRTALMGLSPWRKGPFDLFGVHVDTEWRSDWKWSRVAPHLNLKGK
RILDVGCGNGYYMWRMLGAGADSVIGVDPNWLFFCQFQAVQRYLSEPNAWHLPFPFEDLP
PNLEGFDTVFSMGVFYHRRSPIEHLLALKDCLVKGGELVLETLVVEGDKHQVLVPEDRYA
QMRNVWFLPSVPALELWLRRAGFTDVKCVDVSTTTIEEQRGTEWMKYQSLSDFLDPEDHS
KTIEGLPAPMRAVIVARK