Protein Info for PfGW456L13_4745 in Pseudomonas fluorescens GW456-L13

Annotation: Hydrolase of the alpha/beta superfamily in cluster with COG2110

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 63 to 168 (106 residues), 51.3 bits, see alignment E=2.5e-17 PF00561: Abhydrolase_1" amino acids 67 to 171 (105 residues), 44.7 bits, see alignment E=3.5e-15 PF12697: Abhydrolase_6" amino acids 68 to 246 (179 residues), 35.7 bits, see alignment E=3.9e-12

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 88% identity to pfo:Pfl01_1064)

Predicted SEED Role

"Hydrolase of the alpha/beta superfamily in cluster with COG2110"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QW76 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PfGW456L13_4745 Hydrolase of the alpha/beta superfamily in cluster with COG2110 (Pseudomonas fluorescens GW456-L13)
MRILGIVCLLLALNGCSSLLFYPEPGQLFTPEKAGLEYRTVTLNTADGLKLNAWWLPVKQ
GVEVKGTVLHLHGNGGNLPMHLGGSWWLPEQGYQVLLVDYRGYGLSEGKPSLPAIYQDID
AAFKWLDQATEVKGKPLILLGQSLGGSMAVHYLVQHPERQKQLKAFVLDGVPASYRSVGR
YALSNSWVFWTFQVPLSWLVPDGDSAINSMTQLKDVPKLIYHSIDDPIVPLSNGIRLYQA
APPPRVLQLTRGGHVQTFADPVWRKVMLRYLDDPQHFNGLRRLGEIPNYPAPPNSEDEPP
ESPQ