Protein Info for PfGW456L13_4636 in Pseudomonas fluorescens GW456-L13

Annotation: Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 128 (108 residues), 69.5 bits, see alignment E=1.5e-23 PF00528: BPD_transp_1" amino acids 42 to 233 (192 residues), 91.4 bits, see alignment E=3e-30

Best Hits

Swiss-Prot: 61% identical to HISQ_SALTY: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 93% identity to pba:PSEBR_a1154)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQW3 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PfGW456L13_4636 Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1) (Pseudomonas fluorescens GW456-L13)
MFETLLENLGLSAFSLKGFGPLLMQGTWMTIKLSALSLLLAVLLGLLGASAKLSKVKLMR
VPAQLYTTLIRGVPDLVLMLLIFYSLQTWLTSFTDYMEWEYIEINPFSAGVITLGFIYGA
YFTETFRGAILAVPRGQVEAATAYGLKRGQRFWIVVFPQMMRYALPGIGNNWMVMLKATA
LVSIIGLADLVKAAQDAGKSTYQLFYFLVLAALIYLVITSASNVILRWLERRYSAGTREA
VR