Protein Info for PfGW456L13_4633 in Pseudomonas fluorescens GW456-L13

Annotation: Isochorismatase (EC 3.3.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 7 to 152 (146 residues), 103 bits, E=1.1e-33

Best Hits

Swiss-Prot: 42% identical to Y2328_HALVD: Uncharacterized isochorismatase family protein HVO_2328 (HVO_2328) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 82% identity to pfo:Pfl01_1215)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

• superpathway of chorismate metabolism (42/59 steps found)
• 2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
• enterobactin biosynthesis (4/11 steps found)
• vibriobactin biosynthesis (1/9 steps found)
• bacillibactin biosynthesis (3/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

See A0A293QVX5 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PfGW456L13_4633 Isochorismatase (EC 3.3.2.1) (Pseudomonas fluorescens GW456-L13)
MELKANAALIIIDQQKGILHPRLGRRNNPEAEARMLDLLGHWRRTARPVIHVQHLSRSED
SVFWPQQSGVEFQERFEPMAGERLIQKQVPDAFCSTGLEAQLREAGIGQLIIVGVATHNS
VESTARTAGNLGFDTWVAEDACFTFDKADFFGQAHSAEVVHAMSLGNLHGEYATVVSTAC
VLTAD