Protein Info for PfGW456L13_4540 in Pseudomonas fluorescens GW456-L13

Annotation: Trans-aconitate 2-methyltransferase (EC 2.1.1.144)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13489: Methyltransf_23" amino acids 17 to 141 (125 residues), 57.1 bits, see alignment E=5.7e-19 PF01135: PCMT" amino acids 34 to 130 (97 residues), 22 bits, see alignment E=3.7e-08 PF08241: Methyltransf_11" amino acids 35 to 126 (92 residues), 57 bits, see alignment E=7.5e-19 PF13649: Methyltransf_25" amino acids 35 to 123 (89 residues), 60 bits, see alignment E=9.2e-20 PF08242: Methyltransf_12" amino acids 35 to 125 (91 residues), 55.7 bits, see alignment E=2.1e-18 PF13847: Methyltransf_31" amino acids 35 to 141 (107 residues), 57.2 bits, see alignment E=5.1e-19

Best Hits

Swiss-Prot: 58% identical to TAM_METNO: Trans-aconitate 2-methyltransferase (tam) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 81% identity to pfo:Pfl01_1327)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q5M5 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PfGW456L13_4540 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) (Pseudomonas fluorescens GW456-L13)
MSWSAKQYVAFEDERTRPARDLLAAVPAGDVRLAIDIGCGPGNSTELLVERFADATVRGL
DSSSDMIDAARKRLPQVQFDIADIDTWNDSGPFDVIFANAVLQWVPDHATLLPSLVSKLA
PGGSLAVQMPDNLNEHSHRLMREVAADGPWVGKLAGAAGQRTEMADASGYYSILKACCTR
VDVWRTTYHHPLAGGASGVVEWFKGSGLRPFLDPLDEAERAQYLKQYQTAIERAYPALAD
GSVLLPFPRLFIVATR