Protein Info for PfGW456L13_451 in Pseudomonas fluorescens GW456-L13

Annotation: Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 10 to 433 (424 residues), 550.4 bits, see alignment E=1.3e-169 PF00296: Bac_luciferase" amino acids 31 to 391 (361 residues), 171.6 bits, see alignment E=1.4e-54

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_0238)

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QGT4 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PfGW456L13_451 Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases (Pseudomonas fluorescens GW456-L13)
MTAAKKKILLNAFNMNCIGHINHGLWTHPRDTSTRYNTLEYWTELAQLLERGLFDGLFIA
DIVGVYDVYQSSVDVPLKESIQLPVNDPLLLVSAMAAVTKNLGFGLTANLTYEAPYLFAR
RLSTLDHLSRGRVGWNIVTGYLDSAAKAMGLSEQVEHDRRYDQADEYLEVLYKLLEGSWE
NGAVLNDPRQRIYAQPDKVHKVEHKGEFYQVEGYHLCEPSPQRTPVLFQAGSSDRGLLFA
GRHAECVFISGQTKASTKAQVDKVRASAVEAGRNPEDIKVFMGLNVIVGATEELAWAKHA
EYLSYASAEAGVAHFSASTGIDFSQYEIDEPIQYVKSNAIQSATKHLQNNDWTRRKLLEQ
HALGGRYITVVGSPQQVADELESWIAETGLDGFNLTRIVTPESYEDFIELVIPELQRRGS
YKTAYDDGTLREKLFQREAHLPEQHTGSTYRR