Protein Info for PfGW456L13_4432 in Pseudomonas fluorescens GW456-L13

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 36 to 451 (416 residues), 424.4 bits, see alignment E=2.5e-131 PF13533: Biotin_lipoyl_2" amino acids 77 to 114 (38 residues), 38.9 bits, see alignment 8.7e-14 PF13437: HlyD_3" amino acids 302 to 408 (107 residues), 53.7 bits, see alignment E=4.5e-18

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 94% identity to pfo:Pfl01_1460)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QVC8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>PfGW456L13_4432 HlyD family secretion protein (Pseudomonas fluorescens GW456-L13)
MSADQGSRGYFDSFNKSAETEYMPETAGASLQDSPRWSRITVWLAAALLVSALVWAKFAV
LQEVTMGEGKAIPSSKVQVIQNLEGGIVTEIFVREGQMVNKGDTLLRLDDTRYLSNKGES
EADRFALTAQVERLSAEAEGRPFKLSEEVIAKAPQVAEDERSLYEQRQRRLASEQRTLSE
QLRQKTQELAEFRSKQGQFSSSLALLQQEMNMSAPLVGTGAVSPVEILRLKRSAVEIRGS
LNATTLAIPRAESAINEIKSKIDESEQTFRSEAAKELNEKRTDLSKITASSIAIDDRVTR
TTVVSPVHGIIKVLKVNTIGGVVQPGSDMVEIVPLEDNLLIEAKVRPQDVAFLHPGQKAM
VKFSAYDYTIYGGLSAKLELIGADTITDDKGNSFYLIQVRTDKNHLGGDVKPLLIIPGMV
ATVDIITGEKTVLDYLLKPVLKARTEAMRER