Protein Info for PfGW456L13_4389 in Pseudomonas fluorescens GW456-L13

Annotation: Nitrate reductase cytochrome c550-type subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03892: NapB" amino acids 42 to 147 (106 residues), 157.5 bits, see alignment E=8.8e-51

Best Hits

KEGG orthology group: K02568, cytochrome c-type protein NapB (inferred from 76% identity to pba:PSEBR_a2089)

Predicted SEED Role

"Nitrate reductase cytochrome c550-type subunit" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QV95 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PfGW456L13_4389 Nitrate reductase cytochrome c550-type subunit (Pseudomonas fluorescens GW456-L13)
MNYRSLSLLVMLLMWLPATFAAEPGYPLDAPAPDGRRVGGTLTQELPAPPIAEDENKDLK
RERNYPDQPPTIPHSIRGYAIDMNSNKCLTCHSRANSARTQAPMISITHYMDRDGQALAA
VSPRRYFCNQCHVPQKDVKPLVSNSFKNIDQVLQDEINHQPKP