Protein Info for PfGW456L13_4388 in Pseudomonas fluorescens GW456-L13
Annotation: Cytochrome c-type protein NapC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to NAPC_RHOS4: Cytochrome c-type protein NapC (napC) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 89% identity to pba:PSEBR_a2088)MetaCyc: 58% identical to NapC (Aliivibrio fischeri)
RXN-15816 [EC: 7.1.1.8]
Predicted SEED Role
"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase
MetaCyc Pathways
- aerobic respiration I (cytochrome c) (3/4 steps found)
- aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
- sn-glycerol 3-phosphate anaerobic respiration (2/3 steps found)
- formate to nitrite electron transfer (1/3 steps found)
- Fe(II) oxidation (3/6 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.1.1.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QSJ5 at UniProt or InterPro
Protein Sequence (198 amino acids)
>PfGW456L13_4388 Cytochrome c-type protein NapC (Pseudomonas fluorescens GW456-L13) MKSLLALLKDYWAVLRRPSVHYSLGFLTLGGFIAGVIFWGGFNTALEATNTEKFCTSCHE MRDNVFVELQETIHYTNRSGVRATCPDCHVPHEWTHKIARKMQASKEVWGKLFGTISTRD KFLGMRRELAEHEWARLKANDSRECRNCHNFEFMDFTRQGKRAANMHSTSLASGQATCID CHKGIAHKLPDMSGVKGW