Protein Info for PfGW456L13_4246 in Pseudomonas fluorescens GW456-L13

Annotation: O-methyltransferase family protein [C1]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF01596: Methyltransf_3" amino acids 19 to 216 (198 residues), 230.4 bits, see alignment E=1.3e-72 PF13578: Methyltransf_24" amino acids 65 to 168 (104 residues), 60.6 bits, see alignment E=2.4e-20

Best Hits

Swiss-Prot: 52% identical to MDMC_STRMY: O-methyltransferase MdmC (mdmC) from Streptomyces mycarofaciens

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 87% identity to pfl:PFL_4434)

MetaCyc: 51% identical to (R)-2-hydroxymalonyl-[acp] 2-O-methyltransferase (Streptomyces hygroscopicus ascomyceticus)
2.1.1.-

Predicted SEED Role

"O-methyltransferase family protein [C1]"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QTR0 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PfGW456L13_4246 O-methyltransferase family protein [C1] (Pseudomonas fluorescens GW456-L13)
MTARTLNLDDALYQYLLDVSLRETPLLKRLRDETQALPMARWQVAPEQGQFLALLVKLTG
ARRLLEVGTFTGYSALCMAAALPAGGSLICCDIPGDYNATALRYWQEAGLAGRIDLRLAP
ALETLGKLDQPGQFDLIFIDADKANYPAYLEHALRLLRVGGLAVFDNTLWSGRVLETSPE
SADTRAIQALNRALKDDARVDLSLLPLGDGLTLCRKR