Protein Info for PfGW456L13_4184 in Pseudomonas fluorescens GW456-L13

Annotation: FIG137887: membrane protein related to purine degradation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF06181: Urate_ox_N" amino acids 1 to 287 (287 residues), 409.3 bits, see alignment E=5.1e-127

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfo:Pfl01_1702)

Predicted SEED Role

"FIG137887: membrane protein related to purine degradation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QUS3 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PfGW456L13_4184 FIG137887: membrane protein related to purine degradation (Pseudomonas fluorescens GW456-L13)
LEWLNLSVRWVHMITGVAWIGASFYFVWLENNLNRVNPKSGLAGDLWAIHGGGIYHLEKY
KLAPPTMPDNLHWFKWEAYFTWMSGIALLCVVFYSNPTLYLLAPGSTLSGPEGVAIGLGS
LFIGWFIYSFLCDSALGKRPALLGFILFVLIIGAAYGFSKVFSGRGAYLHVGAIIGTIMV
GNVFRIIMPAQRALVAAIAENRTPDPALPAKGLLRSRHNNYFTLPVLFIMISNHFPSTYG
SQYNWLILAGIAVLAVLVRHYFNTRHDSHKFAWTLPVAAVGMICLAYVSGPKPMSSAPEV
ANAPAKIEYQPLPETAVGGGLKPAEAKPAQAPAAAPAQASNAGPGFDKVHSVIQERCTVC
HSAKPTSPLFSAAPAGVMLDTPEQIRQNAPRIQAQAVTSQIMPLGNITQMTQQERDLIGA
WIVQGAQTN