Protein Info for PfGW456L13_4152 in Pseudomonas fluorescens GW456-L13

Annotation: Protein containing domains DUF404, DUF407

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF14403: CP_ATPgrasp_2" amino acids 72 to 445 (374 residues), 547.4 bits, see alignment E=1.7e-168 PF04174: CP_ATPgrasp_1" amino acids 72 to 401 (330 residues), 498 bits, see alignment E=1.1e-153

Best Hits

Swiss-Prot: 50% identical to Y605_MYCLE: Uncharacterized protein ML0605 (ML0605) from Mycobacterium leprae (strain TN)

KEGG orthology group: None (inferred from 97% identity to pfo:Pfl01_1735)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QUP4 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PfGW456L13_4152 Protein containing domains DUF404, DUF407 (Pseudomonas fluorescens GW456-L13)
MIRNYFDEMYDAGGQVRPHYREFARWLAETPDELLAQRRREADLLFHRAGITFTLYGDEQ
GTERLIPFDTIPRSIPASEWRIVERGCIQRVKALNMFLADLYHEQRIIKAGIIPAEQVLA
NEQYQLAMQGLDLHRDIYSHISGVDLVRDGDGTYYVLEDNLRTPSGVSYMLEDRKMMMRL
FPELFAAQRIAPIDHYPNLLLDTLKSSSPIDNPSVVVLTPGRFNSAFFEHAFLAREMGVE
LVEGADLFVRDDKVYMRTTDGPKAVDVIYRRLDDAFLDPLAFNPESMLGVPGLLSSYRSG
NVVLANAIGTGVADDKSVYPFVTDMIRFYLDEEPILKNVPTWQCRNPSELSHVLANLPEL
VVKETQGSGGYGMLVGPAATAAEIEAFRARIIAKPHAYIAQPTLSLSTCPTFVENGIAPR
HIDLRPFVLSGRETRVVPGGLTRVALREGSLVVNSSQGGGTKDTWVVED