Protein Info for PfGW456L13_4086 in Pseudomonas fluorescens GW456-L13

Annotation: XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF02625: XdhC_CoxI" amino acids 12 to 76 (65 residues), 71.8 bits, see alignment E=3.7e-24 TIGR02964: xanthine dehydrogenase accessory protein XdhC" amino acids 19 to 249 (231 residues), 330.6 bits, see alignment E=3.1e-103 PF13478: XdhC_C" amino acids 107 to 248 (142 residues), 120.7 bits, see alignment E=5.6e-39

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 93% identity to pfo:Pfl01_1795)

Predicted SEED Role

"XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase)" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QTB4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>PfGW456L13_4086 XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase) (Pseudomonas fluorescens GW456-L13)
MYNWIDALADLQNQGEPCVLVTIIEELGSTPRNAGSKMVISANQSFDTIGGGHLEYKAMK
IAREMLASGKQDTHLERFSLGASLGQCCGGATVLLFEPMGQVQAQIAVFGAGHVGRALVP
LLASLPCRVRWIDSREDEFPEQIPHGVRKIVSEEPVDEIDDLPAGSYYIVMTHNHQLDLE
LTAAILKRNDFAYFGLIGSKTKRVKFEHRLRDRGFDNSVVQRMRCPMGIGEVKGKLPVEI
AISIAGEIIATYNANFGQQTSSAGSIAKLLPASRRSQASN