Protein Info for PfGW456L13_4075 in Pseudomonas fluorescens GW456-L13

Annotation: Putative oxidoreductase YncB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF16884: ADH_N_2" amino acids 10 to 115 (106 residues), 136.7 bits, see alignment E=4.3e-44 PF00107: ADH_zinc_N" amino acids 160 to 288 (129 residues), 70.9 bits, see alignment E=1.5e-23 PF13602: ADH_zinc_N_2" amino acids 193 to 338 (146 residues), 58.2 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 64% identical to CURA_ECOLI: NADPH-dependent curcumin reductase (curA) from Escherichia coli (strain K12)

KEGG orthology group: K07119, (no description) (inferred from 88% identity to pfo:Pfl01_1807)

MetaCyc: 64% identical to NADPH-dependent curcumin/dihydrocurcumin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6676; RXN0-6677

Predicted SEED Role

"Putative oxidoreductase YncB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q4D1 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PfGW456L13_4075 Putative oxidoreductase YncB (Pseudomonas fluorescens GW456-L13)
MSDPMTLNQRIVLASRPVGAPTPENFRMERVALPDLADGQVLLKTVFLSLDPYMRGRMSD
APSYAAPVEIGEVMTGGAVSRVERSLNPKFQEGDLVVGATGWQSHSINDGRSIIPIPALP
SPSMALGVLGMPGMTAYMGLMDIGQPKAGETLVVAAASGAVGSVVGQVAKIKGLRVVGVA
GGAEKCRYVVDELGFDACIDHKSPDFADELAQACPKGIDIYYENVGGKVFDAVVPLLNPK
ARIPLCGLIASYNAHEAPSGPDHLPLLQRTLLTKRVRIQGFIVFDDYGDRQPEFLSAMAP
WVRDGKVKFREDVVDGLEQAPDAFIGLLEGRNFGKLVVRVSRD