Protein Info for PfGW456L13_4065 in Pseudomonas fluorescens GW456-L13

Annotation: Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 40 to 469 (430 residues), 586.5 bits, see alignment E=1.8e-180 PF13746: Fer4_18" amino acids 218 to 323 (106 residues), 152.4 bits, see alignment E=1.9e-48 PF11614: FixG_C" amino acids 353 to 469 (117 residues), 105 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_1818)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QT92 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PfGW456L13_4065 Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation (Pseudomonas fluorescens GW456-L13)
MMSNQIPVHDVTPPTKNANNSVDLYASREKIYTRAFTGLFRNLRMTGGALLFLLYFGTVW
LDWGGHQAVWWNLPERKFFIFGATFWPQDFILLSGMLIIAAFGLFFITVYAGRVWCGYTC
PQSVWTWIFMWCEKVTEGDRNQRIKLDKAPMSANKFVRKLSKHSLWLLIGFVTGMTFVGY
FSPIRELVFEFFTGQADGWSYFWVGFFTLATYGNAGWLREQVCIYMCPYARFQSVMFDKD
TLIVSYDPRRGEGRGPRKKGIDYKAQGLGDCIDCTMCVQVCPTGIDIRDGLQIECIGCAA
CIDACDAIMDKMDYPRGLISYTTEHNLSGQKTHKLRPRLIGYAIVLLAMISLLVTAFFMR
ALVGFDVSKDRVLYRENAEGRIENVYSLKIMNKDQRDHTYLLEASGLPDLKLQGRREIKV
AAGEIVSQPAELSVAPEKLPSSTNEVKFILKDADDDSVHIEAKSRFIGPQNR