Protein Info for PfGW456L13_3991 in Pseudomonas fluorescens GW456-L13

Annotation: Capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 2 to 378 (377 residues), 423.5 bits, see alignment E=1.4e-130 PF13727: CoA_binding_3" amino acids 2 to 155 (154 residues), 64 bits, see alignment E=1.9e-21 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 2 to 377 (376 residues), 440.8 bits, see alignment E=7.9e-136 PF02397: Bac_transf" amino acids 193 to 376 (184 residues), 227 bits, see alignment E=1.2e-71

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 82% identity to pfo:Pfl01_3829)

Predicted SEED Role

"Capsular polysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QT28 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PfGW456L13_3991 Capsular polysaccharide biosynthesis protein (Pseudomonas fluorescens GW456-L13)
MGWSMTLAALAIVAFLCKANELFSRQIILVWAIGSYIGQALLYVPLHGFSKYYQRALQVE
RRTLIVGTGELALGLANKLRALEHFPLVGLVSSDTTPLLETGAPPVVGPQEELLELIKTH
DIRRLYITLPLSEAVQIEEMYVDLLDAHVDVVWVPDLNSLTLLNHSVSDVDGMPAIHLIE
CPLTSQPTAALSKSLLDKCVALMAIIALSPLLLIIGLAVKFTSHGPVFFKQDRHGWNGKV
IKVWKFRSMRVHDDHEVKQASRNDSRITPIGRFIRRTSIDELPQLFNVLQGHMALVGPRP
HAVAHNNYYSGKILAYMARHRIKPGITGLAQINGCRGETDTIDKMQKRVEIDLKYINNWS
LWLDVKILVKTPFTLLSKDIY