Protein Info for PfGW456L13_3953 in Pseudomonas fluorescens GW456-L13
Annotation: FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 94% identity to pba:PSEBR_a3873)Predicted SEED Role
"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.2.-
Use Curated BLAST to search for 3.1.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QTH5 at UniProt or InterPro
Protein Sequence (145 amino acids)
>PfGW456L13_3953 FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein (Pseudomonas fluorescens GW456-L13) MGWDRETPFIIDLQVSAEDIDGLGHANNAVYVTWLERCAWRHSQRLGLDLVEYRRLDRAM AVVRHEIDYLAAAYEDDELQLATWIVDWDQRLKMTRHFQLVRPSDNTTLLRAQTTFVCIE LSTGKPKRMPAEFIEGYGPALQTPA